PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01504g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family FAR1
Protein Properties Length: 146aa    MW: 16652.1 Da    PI: 9.7688
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01504g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1652.1e-2039124290
                      FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                               +Y+eYA +vGF +r+ +s+ks+r+g+i++r + C     + ++ +    ++++r   r gC+a++ vk+ek g+w+v k++ +Hn
  Peaxi162Scf01504g00001.1  39 YYDEYAGRVGFMTRVLSSSKSERDGSIISRGLGCRGMLDNPRTGSF---ANQKRDRRRDGCTAMILVKREKPGTWVVRKFVRDHN 120
                               8*********************************877666666555...88899999**************************** PP

                      FAR1  87 Hela 90 
                               H+l+
  Peaxi162Scf01504g00001.1 121 HPLV 124
                               **96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.9E-1839124IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MQIIEDKPVV GQVSTYDADR TQELYEGMTF ESEEAARAYY DEYAGRVGFM TRVLSSSKSE  60
RDGSIISRGL GCRGMLDNPR TGSFANQKRD RRRDGCTAMI LVKREKPGTW VVRKFVRDHN  120
HPLVISPSKR RPTFVSFLVL PCINML
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-125HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016478790.16e-80PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
TrEMBLM1CKJ49e-74M1CKJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000694933e-73(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.14e-23FAR1 family protein